PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.060080.1
Common NameCsa_3G076520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 418aa    MW: 45958.7 Da    PI: 9.2728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.060080.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l ++v++ G g+W+++ r  g++R++k+c++rw ++l
   Cucsa.060080.1 29 KGPWTASEDAILMEYVRKNGEGNWNAVQRNSGLNRCGKSCRLRWANHL 76
                     79******************************************9986 PP

2Myb_DNA-binding49.11.3e-1582125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++ eE+ l++++++++G++ W++ a+ ++ gRt++++k++w++
   Cucsa.060080.1  82 KGAFSSEEERLILQLHAKYGNK-WARMAAQLP-GRTDNEIKNYWNT 125
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8382476IPR017930Myb domain
SuperFamilySSF466892.96E-3026123IPR009057Homeodomain-like
SMARTSM007174.1E-142878IPR001005SANT/Myb domain
PfamPF002498.3E-152976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-233083IPR009057Homeodomain-like
CDDcd001671.81E-103176No hitNo description
PROSITE profilePS5129425.30377131IPR017930Myb domain
SMARTSM007175.0E-1681129IPR001005SANT/Myb domain
PfamPF002491.1E-1482125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-2584130IPR009057Homeodomain-like
CDDcd001675.72E-1284125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MTPNTPVGTM GNGGCSGGSG NGGESGLKKG PWTASEDAIL MEYVRKNGEG NWNAVQRNSG  60
LNRCGKSCRL RWANHLRPNL KKGAFSSEEE RLILQLHAKY GNKWARMAAQ LPGRTDNEIK  120
NYWNTRVKRR QRQGLPLYPL DIRPMSAQSQ PTTPTSPLPT TMPMTPTSTP TTPTGGAASS  180
IFQFHSPTTM HSHSPLSSPH QHEPHTFTSF PLNPPNSFTF HRPPPILAAP VRFKHFRTNN  240
NHHSAVNFSH HHPTLMVHSP PPQQLSRVDS FQFPAMTLAT TSSSSPHILH NAHSGMVISN  300
CVGGLKQDLP SSTQFHQMNV PHTGLTFNDE KIGNGMSFSS AGLLEDLLDE AQVLACDANS  360
NNPKLSPSSS LVSPEEQRLF DGFQKFAQDS NTCLFLSNLS NFLIYFVFSF LYFNDCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31231301107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818590.0LN681859.1 Cucumis melo genomic scaffold, anchoredscaffold00078.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149363.10.0PREDICTED: transcription factor MYB104
TrEMBLA0A0A0L7M00.0A0A0A0L7M0_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.17e-68myb domain protein 120
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]